- Recombinant Spiroplasma virus 4 DNA binding protein ORF8 (ORF8)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1055685
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 4,629 Da
- E Coli or Yeast
- 13881
- DNA binding protein ORF8 (ORF8)
Sequence
MRRKVKNTKRHQWRLTHSARSIKRANIMPSNPRGGRRF